<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23338
| Description |
Uncharacterized protein |
| Sequence | MQSAVAEQTPAAERKASTKKKCASWPGGGRAGSKDADSCPKKAAMTAKSTVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ |
| Length | 120 |
| Position | Tail |
| Organism | Paroedura picta |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Lepidosauria> Squamata> Bifurcata> Gekkota> Gekkonidae> Gekkoninae>
Paroedura.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.543 |
| Instability index | 45.09 |
| Isoelectric point | 9.54 |
| Molecular weight | 13348.21 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23338
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.67| 15| 25| 77| 92| 1
---------------------------------------------------------------------------
77- 92 (26.20/21.86) TWlRSYIKL..FQAPCQR
104- 120 (26.48/16.91) TW.RDFRTLeaFHDTCRQ
---------------------------------------------------------------------------
|