<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23336
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MAAAAPQQQQQQLAQAPAQGAPPAAPGVPPGQQPPAQASAAAGAAQLQAPSGLQVAAQAQDFDPVQRFRQLLPQLKESLQNLMKVAAQNFVQNTNIDSGQKSTDGPVQRVDKTLEEFYALCDQLELCLRLAYECLSQSFDSA |
| Length | 142 |
| Position | Tail |
| Organism | Paroedura picta |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Lepidosauria> Squamata> Bifurcata> Gekkota> Gekkonidae> Gekkoninae>
Paroedura.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.368 |
| Instability index | 74.08 |
| Isoelectric point | 4.55 |
| Molecular weight | 15042.69 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23336
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.08| 12| 40| 64| 75| 2
---------------------------------------------------------------------------
64- 75 (22.03/12.71) PVQRFRQLLPQL
106- 117 (21.05/11.91) PVQRVDKTLEEF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.14| 10| 75| 46| 63| 3
---------------------------------------------------------------------------
29- 38 (21.81/ 7.04) PPGQQPPAQA
50- 59 (18.32/ 6.58) PSGLQVAAQA
---------------------------------------------------------------------------
|