<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23332
| Description |
Uncharacterized protein |
| Sequence | MASSLTGMFSHPPQNPPPPPPPPPGPGPGPGPQGAAAVGLTAAPARPPSTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVEQCIQRFLDVARQTECFFLQKRLQLAVQKPEQVIKEDVSELKNELQRKEALIQKHLSKLRHWQQVLEDINVQPKKSDLAQGPLAYLEQASANIPAPLKQT |
| Length | 184 |
| Position | Head |
| Organism | Chiloscyllium punctatum (Brownbanded bambooshark) (Hemiscyllium punctatum) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Chondrichthyes>
Elasmobranchii> Galeomorphii> Galeoidea> Orectolobiformes> Hemiscylliidae>
Chiloscyllium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.488 |
| Instability index | 57.45 |
| Isoelectric point | 5.42 |
| Molecular weight | 20058.57 |
| Publications | PubMed=30297745
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23332
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.27| 24| 30| 77| 106| 1
---------------------------------------------------------------------------
81- 106 (38.68/42.17) RTGV...EQCIQRflDVAR.....QTECFFLQKR
108- 139 (27.59/13.34) QLAVqkpEQVIKE..DVSElknelQRKEALIQKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.52| 12| 32| 2| 13| 2
---------------------------------------------------------------------------
2- 13 (23.54/13.55) ASSLTGMFSHPP
37- 48 (21.99/12.22) AVGLTAAPARPP
---------------------------------------------------------------------------
|