<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23319
Description |
Mediator of RNA polymerase II transcription subunit 15a isoform X2 |
Sequence | MDSTAQTGHVGVVDWQEEVYQKIKYMKELYLPELNELYQKIAIKCQQHDALVLQPKQSDPIEKLKLFKGIIERMITFLQVPKSNISPTYKDKLAQYEKQIVGVLHSNRHKKPASQQPGQNGVGPLQQS |
Length | 128 |
Position | Tail |
Organism | Cinnamomum micranthum f. kanehirae |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Magnoliidae> Laurales> Lauraceae> Cinnamomum.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.639 |
Instability index | 52.39 |
Isoelectric point | 9.12 |
Molecular weight | 14686.80 |
Publications | PubMed=30626928
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23319
No repeats found
No repeats found
|