Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAATPIPASGNPNFEGNPAAPAPPGTDMTGICFSDQLWLKTYPLDRNLVFDYFALSPFYDWTCNNEQLRMRSIHPLDLSQLSKMTGNEYILSEVMEPHLFVIRKQKRESPEKVTPMFTYYILDGSIYQAPQLCNVFASRIARALYHISKAFTTAASKLEKTGFVDSESESASLEPKIGKEMIDYKDVKRVDHILAALQRKLPPTPPPPPFPEGYVPPATSEQEKGPEAQQQSEPQLPPLDPIIDQGPSKRLRY |
Length | 253 |
Position | Head |
Organism | Cinnamomum micranthum f. kanehirae |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Magnoliidae> Laurales> Lauraceae> Cinnamomum. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.488 |
Instability index | 63.35 |
Isoelectric point | 5.65 |
Molecular weight | 28414.10 |
Publications | PubMed=30626928 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP23298 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.08| 20| 30| 24| 45| 1 --------------------------------------------------------------------------- 24- 45 (36.65/31.18) PGTDMTgiCFSDQLWLKT.YPLD 57- 77 (38.43/25.45) PFYDWT..CNNEQLRMRSiHPLD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.23| 15| 19| 212| 226| 2 --------------------------------------------------------------------------- 212- 226 (27.97/12.34) EGYVPPATSEQEKGP 233- 247 (29.26/13.20) EPQLPPLDPIIDQGP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KRVDHILAALQRKL 2) LPPLDPIIDQGPSKRLRY | 188 236 | 201 253 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab