<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23298
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAATPIPASGNPNFEGNPAAPAPPGTDMTGICFSDQLWLKTYPLDRNLVFDYFALSPFYDWTCNNEQLRMRSIHPLDLSQLSKMTGNEYILSEVMEPHLFVIRKQKRESPEKVTPMFTYYILDGSIYQAPQLCNVFASRIARALYHISKAFTTAASKLEKTGFVDSESESASLEPKIGKEMIDYKDVKRVDHILAALQRKLPPTPPPPPFPEGYVPPATSEQEKGPEAQQQSEPQLPPLDPIIDQGPSKRLRY |
| Length | 253 |
| Position | Head |
| Organism | Cinnamomum micranthum f. kanehirae |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Magnoliidae> Laurales> Lauraceae> Cinnamomum.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.488 |
| Instability index | 63.35 |
| Isoelectric point | 5.65 |
| Molecular weight | 28414.10 |
| Publications | PubMed=30626928
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23298
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.08| 20| 30| 24| 45| 1
---------------------------------------------------------------------------
24- 45 (36.65/31.18) PGTDMTgiCFSDQLWLKT.YPLD
57- 77 (38.43/25.45) PFYDWT..CNNEQLRMRSiHPLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.23| 15| 19| 212| 226| 2
---------------------------------------------------------------------------
212- 226 (27.97/12.34) EGYVPPATSEQEKGP
233- 247 (29.26/13.20) EPQLPPLDPIIDQGP
---------------------------------------------------------------------------
|