<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23284

Description Heat shock cognate protein 2
SequenceMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKLIPGPGDKPMIVVQYKGEDKQFAAEEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKSKKDISGNARALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQDAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKISSKLADGDKKKIEEAIEQAIQWLDSNQLAEADEFDDKMKELESICNPIIAKMYQGAGASADMAGGVDEDDGPSVGGTGAGPKIEEVD
Length651
PositionUnknown
OrganismCinnamomum micranthum f. kanehirae
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Magnoliidae> Laurales> Lauraceae> Cinnamomum.
Aromaticity0.06
Grand average of hydropathy-0.398
Instability index33.25
Isoelectric point5.07
Molecular weight71325.93
Publications
PubMed=30626928

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23284
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.84|      14|      41|     341|     356|       1
---------------------------------------------------------------------------
  341-  356 (18.82/18.80)	VLVGGSTRipKVQQLL
  385-  398 (24.01/15.19)	ILSGEGNE..KVQDLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.84|      25|      74|     554|     578|       2
---------------------------------------------------------------------------
  511-  535 (39.73/28.96)	NDKGRLSKDEIEKMVQDAEKYKSED
  554-  578 (40.11/29.31)	NMRNTIKDEKISSKLADGDKKKIEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.62|      17|     189|     170|     188|       4
---------------------------------------------------------------------------
  170-  188 (22.05/20.55)	GLNVMRIINePTaAAIAYG
  362-  378 (31.58/18.66)	GKELCKSIN.PD.EAVAYG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.82|      17|      21|      38|      55|       7
---------------------------------------------------------------------------
   38-   55 (26.86/24.95)	NR..TTPSYVAFtDSERLIG
   60-   78 (26.96/19.04)	NQvaMNPINTVF.DAKRLIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     110.19|      34|      44|     427|     461|       9
---------------------------------------------------------------------------
  427-  461 (53.16/33.94)	PTKKEQVFSTYSDNQPGVLiQVYEGERTRTRDNNL
  474-  507 (57.02/32.47)	PRGVPQITVCFDIDANGIL.NVSAEDKTTGQKNKI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23284 with Med37 domain of Kingdom Viridiplantae
Unable to open file!