<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23275

Description Mediator of RNA polymerase II transcription subunit 11
SequenceMAMASPMDRLQVLDNIEKDIATVLQSAGQALNELSKDKPANKQVEAHVNQFRQTLTNVETELAKQINYLTQVSTGQAHEGSSYNSQKTLQMAMHRLDHAKTRVNELEATKTKHMQLMQQHQMQRQQGMQQPPPSMSVREHALWVTLVYTPFTFLLIPHPPVYSLSNPSPNSMPSLLLTSSPNFLLPFSTSPPFTLITLPFSLSLFFPS
Length208
PositionHead
OrganismPenaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Multicrustacea> Malacostraca> Eumalacostraca> Eucarida> Decapoda> Dendrobranchiata> Penaeoidea> Penaeidae> Penaeus.
Aromaticity0.07
Grand average of hydropathy-0.353
Instability index57.83
Isoelectric point8.06
Molecular weight23413.60
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364147

GO - Cellular Component
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23275
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     138.89|      39|      45|      11|      52|       1
---------------------------------------------------------------------------
   11-   49 (62.85/41.50)	QVLDNIE....KDIATVLQ.SAGQALNELSKDKPANKQ.VEAHVN
   53-   94 (47.29/38.18)	QTLTNVEtelaKQINYLTQvSTGQAHEGSSYNSQKTLQ.MAMH..
   96-  122 (28.75/16.26)	.................LD.HAKTRVNELEATKTKHMQlMQQHQM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.96|      12|      39|     150|     165|       2
---------------------------------------------------------------------------
  150-  165 (18.50/19.45)	PFTFLLIPhppvYSLS
  192-  203 (23.46/11.79)	PFTLITLP....FSLS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23275 with Med11 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) STGQAHEGSSYNSQKTLQMAMHRLDHAKTRVNELEATKTKHMQLMQQHQMQRQQGMQQPPPS
73
134










Molecular Recognition Features






MoRF SequenceStartStop




NANANA