<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23257
Description |
mediator of RNA polymerase II transcription subunit 18 isoform X2 |
Sequence | MVFCTLKGRRSLPSKKADMECVVQGIIETQHVEALEILLQGLCGVQRERLRIHEICLKNGPNLGLVASEVRLLCDLEQTEPSWTVRHIGGAMRGAGAEQISVLVRTMVESKVSKNVLRMFYTLGYKLDHELLRVGFSFQFNRGAQITVTVSSVNKMLKLHATDEAVPVTPGIQMVEVTAPASAENYTEVAAAVSSFCEYLAPLLHLSKPGVSTGVVPTAAAAAASLMSDGGGTTL |
Length | 235 |
Position | Head |
Organism | Cicer arietinum (Chickpea) (Garbanzo) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
|
Aromaticity | 0.05 |
Grand average of hydropathy | 0.189 |
Instability index | 40.61 |
Isoelectric point | 7.00 |
Molecular weight | 25266.11 |
Publications | PubMed=26259924
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP23257
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.93| 16| 42| 145| 160| 2
---------------------------------------------------------------------------
99- 120 (16.38/10.87) QISVLVrtmveSKVSKnVLRMF
145- 160 (27.55/22.98) QITVTV.....SSVNK.MLKLH
---------------------------------------------------------------------------
|