<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23248
| Description |
mediator of RNA polymerase II transcription subunit 18 isoform X3 |
| Sequence | MQLQKKADMECVVQGIIETQHVEALEILLQGLCGVQRERLRIHEICLKNGPNLGLVASEVRLLCDLEQTEPSWTVRHIGGAMRGAGAEQISVLVRTMVESKVSKNVLRMFYTLGYKLDHELLRVGFSFQFNRGAQITVTVSSVNKMLKLHATDEAVPVTPGIQMVEVTAPASAENYTEVAAAVSSFCEYLAPLLHLSKPGVSTGVVPTAAAAAASLMSDGGGTTL |
| Length | 225 |
| Position | Head |
| Organism | Cicer arietinum (Chickpea) (Garbanzo) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | 0.183 |
| Instability index | 36.18 |
| Isoelectric point | 6.08 |
| Molecular weight | 24189.79 |
| Publications | PubMed=26259924
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23248
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.93| 16| 42| 135| 150| 2
---------------------------------------------------------------------------
89- 110 (16.38/ 9.17) QISVLVrtmveSKVSKnVLRMF
135- 150 (27.55/19.38) QITVTV.....SSVNK.MLKLH
---------------------------------------------------------------------------
|