<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23234
| Description |
mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MASSQQQAAGASSAAGVSGPGSSGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQIACAKDIHTALLDCANKVTGKTPAPPTGPGGTL |
| Length | 200 |
| Position | Tail |
| Organism | Ursus arctos horribilis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ursus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.387 |
| Instability index | 67.89 |
| Isoelectric point | 5.86 |
| Molecular weight | 21058.62 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23234
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.66| 19| 19| 19| 37| 1
---------------------------------------------------------------------------
5- 28 (26.22/ 7.39) QQQaagASSAAGvsGPGSSGGPGP
29- 49 (31.44/ 9.99) QQQ...PQPPAQlvGPAQSGLLQQ
---------------------------------------------------------------------------
|