<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23233
Description |
mediator of RNA polymerase II transcription subunit 29 |
Sequence | MAASQQQAAAASSAAGVSGPGSSGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQIACAKDIHTALLDCANKVTGKTPAPPTGPGGTL |
Length | 200 |
Position | Tail |
Organism | Vulpes vulpes (Red fox) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Canidae> Vulpes.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.363 |
Instability index | 67.35 |
Isoelectric point | 5.86 |
Molecular weight | 21056.64 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23233
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.68| 14| 167| 14| 27| 1
---------------------------------------------------------------------------
14- 27 (27.75/11.93) AAGVSG..PGSSGGPG
182- 197 (22.93/ 8.82) ANKVTGktPAPPTGPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.02| 20| 22| 29| 48| 2
---------------------------------------------------------------------------
29- 48 (36.95/15.80) QQQPQPPAQ...LVGPAQSGLLQ
50- 72 (31.07/12.38) QQQDFDPVQrykMLIPQLKESLQ
---------------------------------------------------------------------------
|