<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23221
Description |
Uncharacterized protein |
Sequence | METLFYFLRIRLNFFICVHIQDLINFPLILGASLHEQPNKLYMTLNRKRLVVEAQSLMQKIMENLLSYRMKVAIHCKEYSNTIPINSENLREIVMEMEYLPISSWETSHMIMSDFFKIWKETLGKKIITGLFYAC |
Length | 135 |
Position | Head |
Organism | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum>
Solanum subgen. Lycopersicon.
|
Aromaticity | 0.12 |
Grand average of hydropathy | 0.121 |
Instability index | 40.58 |
Isoelectric point | 8.44 |
Molecular weight | 16102.99 |
Publications | PubMed=22660326
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP23221
No repeats found
No repeats found
|