<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23209
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDSSQHNSAAGSIGGNGIINPRSNDASPADLAANAVASAAGSPAEESKQNLNQVINSIDKTLGILHQLNLTVSSYNVSSQLPLLQRMNNLVLELDNMAKLGEKCNIQVPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRGHLLEDLEQAFPEEVEAYREIRAASAAEAKRLAQAQSLLPNGDVKVKPEV |
| Length | 201 |
| Position | Middle |
| Organism | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum>
Solanum subgen. Lycopersicon.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.364 |
| Instability index | 39.45 |
| Isoelectric point | 5.00 |
| Molecular weight | 21541.96 |
| Publications | PubMed=22660326
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP23209
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.44| 24| 34| 49| 72| 2
---------------------------------------------------------------------------
49- 72 (37.79/24.05) QNLNQVINSIDKTLGILHQLNLTV
85- 108 (39.65/25.53) QRMNNLVLELDNMAKLGEKCNIQV
---------------------------------------------------------------------------
|