<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23196
Description |
Uncharacterized protein |
Sequence | MDPDNKRFGRGPRELTGAVDLISHFKLLPHQEFFCKRSLPLSISDTHYLHNVVGDTEIRKGEGMQLDQLIQDTSLSRETSSCIQPFDLDVLGEAFRLREAAPVDLPPSEKGIPTVAGKSKSESKDKEKKHKKHKDKDKEKDKEHKKHKHRHKDRSKDKDKDKKRDKSVHHDSGADLSKKHHEKGENVKEIKVYLS |
Length | 195 |
Position | Head |
Organism | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum>
Solanum subgen. Lycopersicon.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.281 |
Instability index | 35.75 |
Isoelectric point | 9.29 |
Molecular weight | 22410.07 |
Publications | PubMed=22660326
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP23196
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 74.26| 15| 15| 139| 153| 2
---------------------------------------------------------------------------
139- 153 (27.07/10.34) EKDKEHKKHKHRHKD
157- 171 (25.18/ 9.17) DKDKDKKRDKSVHHD
175- 189 (22.01/ 7.21) DLSKKHHEKGENVKE
---------------------------------------------------------------------------
|