<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23186

Description Uncharacterized protein
SequenceMASNPPPSGPQPLWPPSVGSTPPQGFGSFPMQFRPALSTQQGQHFAPPISASPQYRPVGQTPNAGMPPGQGQIPQFSQTMQQFPPRPGQPGHGTPSSQAIQMSYNQSSISQPQQVNPPLNSHMPGVSGAGNPFSSSYTVQSSSQMHGPTFPAGGQPWLSSGSQTTPVGDPTPPSSHQLLAVAPAVPASTASQQTASDWQEYEAADGRRYYYNKNTKQSSWEKPLELMTPLERADASTVWKEFTTADGRKYYYNKETKQSKWTMPDELKLARELAENVASQVVQTGTSTNSGVQVSEAVTSTEQPSAVTPVSSTPSSTVSGVPSSPVPVTPAVSDVNTPPLVVSGSSAIPTVSFAVTSSAGISSPAVSGNTRSAALANAYQTQMSGIENLSPQVASSLSGASSQDIEEAKKGMAVAGKINVVPAEEKSADEEPFLYATKQEAKHAFKSLLESATVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRLRQRKAKEEFTKMLEESKELTSSTRWSKAVTMFEDDERFKGVEREADREDLFRNYLVDLQKKERSKAQEEYRRNRLEYKQFLETCGFIKVDTQWRKVQDLLEDDERCSRLEKLDRLDIFQEYIRDLEKEDEEQRKLQKEQLRRAERKNRDAFRKMIEEHIAAGMLTAKTYWRDYWQMVKESVAYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKIHVKDVVKSEKITISPTCTFEDFKVAILEGISSPSIQDVNLQLIFEDLVERAKEKEEKEAKKRQRLAKDFTDKLSSIKEITDSSSWEESKELVEDSSEFRAIGEETISRAVFEEYVAWLQEKAKEKERKREEEKVKKEKEKDEKEKRKDKERREKEKEREKEKERGKERSRKDEPDSVIMDVTESFEHKEERKREKDRERKHRKRHHSSNDELTSDKDEKEESERDKERKHRKRHQSSNDEVASDRDEREDLRKSHRHSSDRKKSKKHAHSPESDGESRHKRYRRDRDGSRRNGGHEELEDGELGEDGES
Length1027
PositionUnknown
OrganismSolanum lycopersicum (Tomato) (Lycopersicon esculentum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum> Solanum subgen. Lycopersicon.
Aromaticity0.07
Grand average of hydropathy-1.140
Instability index59.58
Isoelectric point6.05
Molecular weight116852.90
Publications
PubMed=22660326

Function

Annotated function 
GO - Cellular Component
U1 snRNP	GO:0005685	IBA:GO_Central
U2-type prespliceosome	GO:0071004	IBA:GO_Central

GO - Biological Function
RNA binding	GO:0003723	IBA:GO_Central

GO - Biological Process
mRNA cis splicing, via spliceosome	GO:0045292	IEA:InterPro
mRNA splicing, via spliceosome	GO:0000398	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23186
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     141.44|      28|      28|     912|     939|       1
---------------------------------------------------------------------------
  899-  929 (42.51/19.03)	VTESFEHKEErkrEKDRERKH.RK........RHHSSNDE
  930-  958 (48.38/22.70)	LTSDKDEKEE..sERDKERKH.RK........RHQSSNDE
  959-  979 (23.12/ 6.90)	VASDRDERED...........lRK........SHRHSSDR
  980- 1015 (27.44/ 9.60)	KKSKKHAHSP...ESDGESRH.KRyrrdrdgsRRNGGHEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     175.42|      38|      38|     195|     232|       2
---------------------------------------------------------------------------
  195-  232 (76.74/44.35)	ASD.WQEYEAADGRRYYYNKNTKQSSWEKPLELMTPLER
  235-  271 (64.23/35.95)	ASTvWKEFTTADGRKYYYNKETKQSKWTMPDEL..KLAR
  289-  314 (34.45/15.93)	NSG.VQVSEAVTS........TEQPSAVTPVS.STP...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     113.85|      19|      21|      53|      71|       3
---------------------------------------------------------------------------
   12-   27 (25.09/10.86)	PLW.........PPsVGSTP......PQGFG
   31-   51 (22.90/ 9.23)	MQF.........RP.ALSTQQGQhfAPPISA
   53-   71 (40.66/22.39)	PQY.........RP.VGQTPNAG..MPPGQG
   74-   99 (25.20/10.93)	PQFsqtmqqfppRP..GQ.PGHG..TPSSQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.32|      22|      23|     837|     858|       4
---------------------------------------------------------------------------
  538-  563 (21.07/ 6.73)	DERFKGVEREADREDLFRnylvDLQK
  837-  858 (31.83/13.72)	QEKAKEKERKREEEKVKK....EKEK
  861-  876 (26.42/10.20)	KEKRKDKERR......EK....EKER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.42|      16|      32|     321|     337|       5
---------------------------------------------------------------------------
  321-  337 (26.48/22.36)	VPSSPVPVT.......PAVSDvNT
  348-  370 (22.94/13.53)	IPTVSFAVTssagissPAVSG.NT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     100.63|      23|      23|     585|     607|       6
---------------------------------------------------------------------------
  585-  607 (39.94/29.16)	ETCGF..I....KV............DTQWRKVQDLLEDDE
  609-  633 (17.97/ 8.32)	..CSR..LekldRL............DIFQEYIRDLEKEDE
  650-  681 (24.19/14.22)	NRDAF..R....KMieehiaagmltaKTYWR...DYWQMVK
  682-  704 (18.53/ 8.85)	ESVAYqaV....AS............NTSGSTPKDLFED..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.65|      22|      23|     115|     136|       7
---------------------------------------------------------------------------
  115-  136 (42.72/22.27)	VNPPLNSHMPGVSGAGNPFSSS
  139-  160 (40.93/21.04)	VQSSSQMHGPTFPAGGQPWLSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.79|      22|      24|     783|     805|       9
---------------------------------------------------------------------------
  783-  805 (32.23/20.34)	LAKDfTDKLSSIKEITDSSS.WEE
  809-  831 (31.56/15.25)	LVED.SSEFRAIGEETISRAvFEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     113.82|      40|      67|     425|     464|      10
---------------------------------------------------------------------------
  425-  464 (71.44/38.33)	E.................KSADEEPFLYATKQE..........AKHAFKSLL.ESATVESDWTWEQ..TM
  465-  534 (42.38/20.06)	RviindkrygalktlgerKQAFNEYLMQRKKQEaeerrlrqrkAKEEFTKMLeESKELTSSTRWSKavTM
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23186 with Med35 domain of Kingdom Viridiplantae
Unable to open file!