<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23182
| Description |
Uncharacterized protein |
| Sequence | MDPDSKNFGRGPRELTGARDLISHFKLLPHYEFFGKRSLPLSISDTHYLHNVVGDTEIRKGEKMQLDQLTQDTSFSRETSSCIRPFDLDVLREAFQLRETAPVNLSPSDKGTPTIAGKSKSEMKDKEKKEKKHKKHKDKDKEKDKEHKKHKHRHKDRSKDKDKEKKKDKSGHNDPGAEHSKKHEKKRKHDEEDLNGVHKHKKSKHRSSKLDEIGSIKVAG |
| Length | 220 |
| Position | Head |
| Organism | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum>
Solanum subgen. Lycopersicon.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.565 |
| Instability index | 40.96 |
| Isoelectric point | 9.66 |
| Molecular weight | 25461.41 |
| Publications | PubMed=22660326
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP23182
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.28| 16| 16| 131| 146| 1
---------------------------------------------------------------------------
131- 146 (30.98/11.70) KKHK.KHKDKDKEKDKE
148- 164 (26.30/ 8.81) KKHKhRHKDRSKDKDKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.74| 16| 18| 179| 195| 3
---------------------------------------------------------------------------
179- 195 (24.44/15.05) HSKKHeKKRKHDEEDLN
196- 211 (28.30/13.42) GVHKH.KKSKHRSSKLD
---------------------------------------------------------------------------
|