<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23176
| Description |
Uncharacterized protein |
| Sequence | MDPDSKKFGRGPRELAGAVDLINHYKLLPHHEYFCKKPLPLSISDTRYLHNVVGDREIRKGEGMQLDQLIHDTSFLKETNSRIQPFELDALNEAFQLREAAPIVLPPSEKGIPTVAGKSKSESKDKEKKHKKHKDKDKEKDKEHKKHKHRHKDRSKDKDKEKKKDKTGRHDSGADLSKKHHEKRKKHEGKEDLNDVNKHKRNKHTS |
| Length | 206 |
| Position | Head |
| Organism | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum>
Solanum subgen. Lycopersicon.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.568 |
| Instability index | 31.32 |
| Isoelectric point | 9.67 |
| Molecular weight | 23980.90 |
| Publications | PubMed=22660326
|
Function
| Annotated function |
ECO:0000256
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP23176
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.52| 15| 15| 124| 138| 1
---------------------------------------------------------------------------
124- 138 (29.67/10.70) KDKEKKHKKHKDKDK
158- 172 (23.85/ 7.20) KDKEKKKDKTGRHDS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.35| 17| 31| 141| 157| 2
---------------------------------------------------------------------------
141- 157 (31.81/12.51) DKEHKKHKHRHKDRSKD
175- 191 (28.54/10.49) DLSKKHHEKRKKHEGKE
---------------------------------------------------------------------------
|