<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23165

Description Uncharacterized protein
SequenceMHCQIWFTCNECLIHTRSMKNSLSSSSESLSSPEDNGGTEMRNNVGNGYEDLNILENASIPANKIVKVEIKGDYSTLHEAHLHCATSQPLLEEGSFHGKASNDERSRVEQAMMDAENSKQRALEESVKRWRAEEDAREAISMNSTCFDFILVTEVRLYQAEASYRLFEEKQVQRKEKEEIFAKQKEEIEELKIQHDLCLNKLQMIQEKKPVLESQITESSCAGKELEEKIIQAVELLISFRKQRDEMQIERDNAIKQVNRFRKLVQDDADEYCIKNFFSISFSDIIEATQNFDPSSKIGEGKFGSVYKGMIHDVKVAIKMLPACGSFSDLDFQHKAESLSRVRHPNLVTLIGICSESRSLAYEFLENGNLEDHLACRKKSRPLHWQHRIRIAVEICSALIFVHANDPCIVHGNLRPTNILLDAKFVSKISDFGVHLLISQTENSNNDDPEASVYVDPECIDKRQLTVESDVYSFGVILLRLLTARPASGIVREVKCALESGNLGSVLDSSAGDWPIEQVELLAYLALSCCEKDPLNRPNMLSEVWPTIEPMRDICKPNSDLNTSSQGSKSQKRIPPHFVCPIFQDVMEDPHIAADGYTYEGDAIKGWLYSGHDTSPMTNLKLDTCDLIPNYALYRAIQEWQQQS
Length644
PositionTail
OrganismSolanum lycopersicum (Tomato) (Lycopersicon esculentum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum> Solanum subgen. Lycopersicon.
Aromaticity0.07
Grand average of hydropathy-0.444
Instability index47.04
Isoelectric point5.20
Molecular weight73007.79
Publications
PubMed=22660326

Function

Annotated function Functions as an E3 ubiquitin ligase.
ECO:0000256	ARBA:ARBA00003861
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23165
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.09|      24|     132|     352|     383|       1
---------------------------------------------------------------------------
   84-  107 (41.56/24.73)	CATSQPL....LEEGSFHGKASNDERSR
  354-  381 (36.54/37.28)	CSESRSLayefLENGNLEDHLACRKKSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.19|      11|      42|     427|     437|       2
---------------------------------------------------------------------------
  427-  437 (20.24/12.23)	SKISDFGVHLL
  469-  479 (19.95/11.96)	SDVYSFGVILL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.51|      26|      42|     109|     134|       3
---------------------------------------------------------------------------
  109-  134 (43.98/34.29)	EQAMMDAENSKQRALEESVKRWRAEE
  154-  179 (42.53/32.90)	EVRLYQAEASYRLFEEKQVQRKEKEE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23165 with Med32 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) EGSFHGKASNDERSRVEQAMMDAENSKQRALEESVK
93
128

Molecular Recognition Features

MoRF SequenceStartStop
NANANA