<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23163
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MDGVGARLGRSSARYAPTTVFTGPVRRWKKKWIQGTPPSSGNNHSRNTANGGVNGSNISHLLLFKWIPITASQNNNDSSSKDDVVSVEEPPKRKFKYIPINVLEEQKNDASEQVEDDIKPIESDTNSEEPTSQADGFDEKPDINDVPMEENHVLGVKAELGFEVYGFSVLVLDRSLPSEYMDSQSQNTSLQRLQNVEKRIVRVLELAGGVMDEMANPSGPRKELINNHCSEFMQLIKDIQVTLREEIKSACEYRPFEKCDYVPRISNEICCKKLDYVISQFDNMKQTIEGYHAAASDHMALD |
| Length | 302 |
| Position | Head |
| Organism | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum>
Solanum subgen. Lycopersicon.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.662 |
| Instability index | 52.51 |
| Isoelectric point | 5.10 |
| Molecular weight | 33941.60 |
| Publications | PubMed=22660326
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23163
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 97.03| 25| 33| 57| 88| 1
---------------------------------------------------------------------------
31- 53 (19.53/17.34) .KWIqgtPPSS.GNNHSRNTAN..GGV....
64- 88 (44.26/21.26) FKWI...PITA.SQNNNDSSSK..DDVVSVE
95- 122 (33.25/13.11) FKYI...PINVlEEQKNDASEQveDDIKPIE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.19| 10| 19| 222| 232| 2
---------------------------------------------------------------------------
222- 232 (14.94/12.83) KELINNHCsEF
244- 253 (18.24/10.41) REEIKSAC.EY
---------------------------------------------------------------------------
|