<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23162
| Description |
Uncharacterized protein |
| Sequence | MDWYNWMAAQTWEGGLGAGAAAGDVHSSDWRIGHAPYTRQRIVNQILEEIQRIFPVFWHQNVQELTEIAVLFEEKTYNVATSWYDYLYRIYSNLRGMAHYCHINTAISGQNAHGPGMTMEATVYETTSGPEDSDKEEDDDVVEEVVGTKEQNNAVGHKDNVRVVENEQESSSNKVVGRPSVFFK |
| Length | 184 |
| Position | Tail |
| Organism | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum>
Solanum subgen. Lycopersicon.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.600 |
| Instability index | 44.47 |
| Isoelectric point | 4.78 |
| Molecular weight | 20905.74 |
| Publications | PubMed=22660326
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23162
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.45| 16| 22| 96| 111| 2
---------------------------------------------------------------------------
96- 111 (30.27/21.22) GMAHYCHINTAISGQN
116- 131 (28.18/19.32) GMTMEATVYETTSGPE
---------------------------------------------------------------------------
|