<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23159

Description Mediator of RNA polymerase II transcription subunit 6
SequenceMASTPMMPLNADGSAPVAPPLPGTDMTSICFRDQLWLNTYPLDKNLVFDYFALSPFYDWTCNNEQLRARAIHPLDFSHISKMTGMEYTLSEVMEPNLFVIRKQKRDSPEKVTPMLTYYILDGSIYQAPQLCNVFAARLIGFDLVLTSDLSVGDPYQYCVKQGRALYHISKAFGTASSKLEKIGYVESENNSQASETKPAKEAIDFKELKRVDHILASLQRKLPAVPLPPPLPEGYAPPSTSEPSENQQPETQPPPIDPIIDQGPSKRMKYNYASVRTIQSLKNKEFNCL
Length289
PositionHead
OrganismSolanum lycopersicum (Tomato) (Lycopersicon esculentum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum> Solanum subgen. Lycopersicon.
Aromaticity0.09
Grand average of hydropathy-0.402
Instability index56.82
Isoelectric point5.87
Molecular weight32471.79
Publications
PubMed=22660326

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
transcription coactivator activity	GO:0003713	IBA:GO_Central
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23159
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.38|      20|      30|      22|      43|       1
---------------------------------------------------------------------------
   22-   43 (37.07/31.14)	PGTDMTsiCFRDQLWLNT.YPLD
   55-   75 (37.32/24.64)	PFYDWT..CNNEQLRARAiHPLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.34|      18|     106|       4|      21|       2
---------------------------------------------------------------------------
    4-   21 (36.06/24.88)	TPMMPLNA.DGSAPVAPPL
  112-  130 (31.27/20.57)	TPMLTYYIlDGSIYQAPQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     113.75|      33|      56|     187|     219|       3
---------------------------------------------------------------------------
  187-  219 (53.29/27.51)	SENNSQASETKPAKEAIDFKELKRVDHILASLQ
  244-  276 (60.46/32.03)	SENQQPETQPPPIDPIIDQGPSKRMKYNYASVR
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23159 with Med6 domain of Kingdom Viridiplantae

Unable to open file!