<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23159
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MASTPMMPLNADGSAPVAPPLPGTDMTSICFRDQLWLNTYPLDKNLVFDYFALSPFYDWTCNNEQLRARAIHPLDFSHISKMTGMEYTLSEVMEPNLFVIRKQKRDSPEKVTPMLTYYILDGSIYQAPQLCNVFAARLIGFDLVLTSDLSVGDPYQYCVKQGRALYHISKAFGTASSKLEKIGYVESENNSQASETKPAKEAIDFKELKRVDHILASLQRKLPAVPLPPPLPEGYAPPSTSEPSENQQPETQPPPIDPIIDQGPSKRMKYNYASVRTIQSLKNKEFNCL |
| Length | 289 |
| Position | Head |
| Organism | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum>
Solanum subgen. Lycopersicon.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.402 |
| Instability index | 56.82 |
| Isoelectric point | 5.87 |
| Molecular weight | 32471.79 |
| Publications | PubMed=22660326
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP23159
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.38| 20| 30| 22| 43| 1
---------------------------------------------------------------------------
22- 43 (37.07/31.14) PGTDMTsiCFRDQLWLNT.YPLD
55- 75 (37.32/24.64) PFYDWT..CNNEQLRARAiHPLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.34| 18| 106| 4| 21| 2
---------------------------------------------------------------------------
4- 21 (36.06/24.88) TPMMPLNA.DGSAPVAPPL
112- 130 (31.27/20.57) TPMLTYYIlDGSIYQAPQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 113.75| 33| 56| 187| 219| 3
---------------------------------------------------------------------------
187- 219 (53.29/27.51) SENNSQASETKPAKEAIDFKELKRVDHILASLQ
244- 276 (60.46/32.03) SENQQPETQPPPIDPIIDQGPSKRMKYNYASVR
---------------------------------------------------------------------------
|