<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23149
| Description |
Uncharacterized protein |
| Sequence | MQSYGGSVESKIQLVCDLEKPEDTWTVRHVGGPMIGSGAEKSSFLVRPVQESKITKNAQIFFKNIGYKLDHKHLRVGFAFHFQKDALITVTVSSINKIFKLHAIDDAVSVTPGTHLVEVTAQTASTNYNEVVASVSSFCEYLALLLHLSKPGVSTGVVPTAVASLMSDG |
| Length | 169 |
| Position | Head |
| Organism | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum>
Solanum subgen. Lycopersicon.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | 0.091 |
| Instability index | 22.58 |
| Isoelectric point | 7.05 |
| Molecular weight | 18264.72 |
| Publications | PubMed=22660326
|
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP23149
No repeats found
No repeats found
|