<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23136
Description |
Uncharacterized protein |
Sequence | MDSGDWRTQLFPESRQRIVNKIMETLKRHLPVSGQQGVEELKKIAVNFEEKIYSAATSQQDYLRKISLKMLTMETKSQNSGSSGHNALSPGEQ |
Length | 93 |
Position | Tail |
Organism | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum>
Solanum subgen. Lycopersicon.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.790 |
Instability index | 58.19 |
Isoelectric point | 9.05 |
Molecular weight | 10538.81 |
Publications | PubMed=22660326
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23136
No repeats found
|