<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23133
Description |
Uncharacterized protein |
Sequence | MAGALGGMFANQPPGPPPPGPPGGPGPAGLIPPPTGPRNPNNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLSKLRHWQQVLEDISVQHKKPAEMPQGPLAYLEQASANIPAPMKQS |
Length | 178 |
Position | Head |
Organism | Gallus gallus (Chicken) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae>
Phasianinae> Gallus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.556 |
Instability index | 58.93 |
Isoelectric point | 5.42 |
Molecular weight | 19525.00 |
Publications | PubMed=15592404
|
Function
Annotated function |
|
GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl
mediator complex GO:0016592 IBA:GO_Central
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP23133
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.72| 15| 16| 105| 119| 2
---------------------------------------------------------------------------
105- 119 (25.06/21.72) QKPEQVIKEDVSELR
123- 137 (24.66/21.26) QRKEALIQKHLSKLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.14| 14| 18| 143| 158| 3
---------------------------------------------------------------------------
143- 158 (21.65/17.89) LEDISvqHKKPAEMPQ
164- 177 (25.49/14.48) LEQAS..ANIPAPMKQ
---------------------------------------------------------------------------
|