<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23124

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMSSKWTVTTLEWNIYGTYILIGDCSGTVSIYTMNDHMFNDWVQLGSTVFEAEHILGGAFFHSGNKLSLMTEKKDSVSYYEKFNYLRLRWLLRLLRLIEDNCLITISTKNTVAWTTRTEINDTTNTTWASHVYVADLNVPWQYHKSPSCPAVFGREHNQLHVMHYFLFYCRLIEDNCLITISTKNTVAWTTRTEINDTTNTTWASHVYVADLNVPWQYHKVMSSKWTVTTLEWNIYGTYILIGDCSGTVSIYTMNDHMFNDWVQLGSTVFEAEHILGGAFFHSGNKLSLMTEKKDSVSYYEKFNYLRFAPSVRQKGGCALEGCIVISKTGLIGVIVLTKTSHNNTTLLTTAESLAVSRYEITSVDICYGKNGHFLIATSCQDTQMPIKCYEVRGNNLI
Length397
PositionTail
OrganismDiaphorina citri (Asian citrus psyllid)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae> Diaphorina.
Aromaticity0.12
Grand average of hydropathy-0.108
Instability index33.70
Isoelectric point6.42
Molecular weight45346.11
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23124
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     633.13|     133|     219|       1|     133|       1
---------------------------------------------------------------------------
    1-  133 (287.29/174.16)	MSSKWTVTTLEWNIYGTYILIGDCSGTVSIYTMNDHMFNDWVQLGSTVFEAEHILGGAFFHSGNKLSLMTEKKDSVSYYEKFNYLR.LRWLLRLL.RLIEDNCLITISTKNT..VAWTTRTEINDTTNTTWASHVYV
  150-  208 (91.12/50.37)	..............................................AVFGREH.............................NQLHvMHYFLFYC.RLIEDNCLITISTKNT..VAWTTRTEINDTTNTTWASHVYV
  221-  355 (254.72/153.61)	MSSKWTVTTLEWNIYGTYILIGDCSGTVSIYTMNDHMFNDWVQLGSTVFEAEHILGGAFFHSGNKLSLMTEKKDSVSYYEKFNYLR.FAPSVRQKgGCALEGCIV.ISKTGLigVIVLTKTSHNNTTLLTTAESLAV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.36|      11|      73|     134|     144|       2
---------------------------------------------------------------------------
  134-  144 (26.68/17.18)	ADLNVPWQYHK
  209-  219 (26.68/17.18)	ADLNVPWQYHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.82|      15|      19|     361|     375|       3
---------------------------------------------------------------------------
  361-  375 (29.45/16.78)	TSVDI.CYGKNGHFLI
  382-  397 (25.37/13.64)	TQMPIkCYEVRGNNLI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23124 with Med16 domain of Kingdom Metazoa
Unable to open file!