<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23124
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MSSKWTVTTLEWNIYGTYILIGDCSGTVSIYTMNDHMFNDWVQLGSTVFEAEHILGGAFFHSGNKLSLMTEKKDSVSYYEKFNYLRLRWLLRLLRLIEDNCLITISTKNTVAWTTRTEINDTTNTTWASHVYVADLNVPWQYHKSPSCPAVFGREHNQLHVMHYFLFYCRLIEDNCLITISTKNTVAWTTRTEINDTTNTTWASHVYVADLNVPWQYHKVMSSKWTVTTLEWNIYGTYILIGDCSGTVSIYTMNDHMFNDWVQLGSTVFEAEHILGGAFFHSGNKLSLMTEKKDSVSYYEKFNYLRFAPSVRQKGGCALEGCIVISKTGLIGVIVLTKTSHNNTTLLTTAESLAVSRYEITSVDICYGKNGHFLIATSCQDTQMPIKCYEVRGNNLI |
| Length | 397 |
| Position | Tail |
| Organism | Diaphorina citri (Asian citrus psyllid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.108 |
| Instability index | 33.70 |
| Isoelectric point | 6.42 |
| Molecular weight | 45346.11 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23124
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 633.13| 133| 219| 1| 133| 1
---------------------------------------------------------------------------
1- 133 (287.29/174.16) MSSKWTVTTLEWNIYGTYILIGDCSGTVSIYTMNDHMFNDWVQLGSTVFEAEHILGGAFFHSGNKLSLMTEKKDSVSYYEKFNYLR.LRWLLRLL.RLIEDNCLITISTKNT..VAWTTRTEINDTTNTTWASHVYV
150- 208 (91.12/50.37) ..............................................AVFGREH.............................NQLHvMHYFLFYC.RLIEDNCLITISTKNT..VAWTTRTEINDTTNTTWASHVYV
221- 355 (254.72/153.61) MSSKWTVTTLEWNIYGTYILIGDCSGTVSIYTMNDHMFNDWVQLGSTVFEAEHILGGAFFHSGNKLSLMTEKKDSVSYYEKFNYLR.FAPSVRQKgGCALEGCIV.ISKTGLigVIVLTKTSHNNTTLLTTAESLAV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.36| 11| 73| 134| 144| 2
---------------------------------------------------------------------------
134- 144 (26.68/17.18) ADLNVPWQYHK
209- 219 (26.68/17.18) ADLNVPWQYHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.82| 15| 19| 361| 375| 3
---------------------------------------------------------------------------
361- 375 (29.45/16.78) TSVDI.CYGKNGHFLI
382- 397 (25.37/13.64) TQMPIkCYEVRGNNLI
---------------------------------------------------------------------------
|