<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23122
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MRITSFIEYLSLVRLRSPNNISGVWLIANRSHFSSQTSESLNNISGVCVGRYSVPGVYKVARVRFIVREDADSVIVAANGETNSVIEVWELVENAYPVNSVFKKSVSLGVGPPAGDPGLKTITWRLQNSYAYEAKVLSVTTSKLCVSNSLPPQAHIIVAYSNGSLTCFLKDSLKQLGFTSVNNMIWAKLDNMKRSRMSVVLSCIDLSWLGNVLA |
| Length | 214 |
| Position | Tail |
| Organism | Diaphorina citri (Asian citrus psyllid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | 0.143 |
| Instability index | 39.88 |
| Isoelectric point | 9.36 |
| Molecular weight | 23492.81 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23122
No repeats found
|