<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23118

Description mediator of RNA polymerase II transcription subunit 27
SequenceMEQTMAVALHSVKLLRLSMNNLFGTLSDGMRMDHGEDHQTAANKFLLELQDLITNLFVHMRELEQAVATLAPPPGPMPLYNSQHLTQESTLDRLALYEPLVQSYKWTDKILGLEPLELEQAVATLAPPPGPMPLYNSQHLTQESTLDRLALYEPLVQSYKWTDKVHEYSNLAWAVLSQNSLKRSYLSQSQKKRRVLTSTHNVPPQTVDTMIASIDRLYQDMSVTVSRPFASNAVLHVRRASQFNIHSAMLHFYSPALPELAVRSFMTWLHSFNTVFSDPCKRCNNYLLNNYPPTWRDYRTLDPYHDECKH
Length310
PositionTail
OrganismDiaphorina citri (Asian citrus psyllid)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae> Diaphorina.
Aromaticity0.09
Grand average of hydropathy-0.379
Instability index49.81
Isoelectric point6.53
Molecular weight35625.26
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23118
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     214.73|      49|      53|      62|     110|       1
---------------------------------------------------------------------------
   62-  110 (107.42/61.42)	ELEQAVATLAPPPGPMPLYNSQHLTQESTLDRLALYEPLVQSYKWTDKI
  117-  165 (107.31/61.35)	ELEQAVATLAPPPGPMPLYNSQHLTQESTLDRLALYEPLVQSYKWTDKV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      73.54|      16|      25|     267|     282|       2
---------------------------------------------------------------------------
  250-  263 (16.95/ 8.16)	..LHFYSPA..LPELAVR
  267-  282 (31.63/21.34)	TWLHSFNTV..FSDPCKR
  294-  310 (24.97/15.36)	TW.RDYRTLdpYHDECKH
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23118 with Med27 domain of Kingdom Metazoa
Unable to open file!