<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23117
| Description |
mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MNIGPPPGMMGQMQGPSPLQGPPQLQGPQQIPGQMPGPPQMQVQQEKFDNISKVKSLTGQLRESLNTTLKTAALNVIQNNIIDSVSVKCAMLAIELNLKTAIECHQQGTSSQRYMNVVVATTRTEPLNTQEANTLTYPQYLSTTRNQVAYAKDIHDMLTKVSHNITQQEPST |
| Length | 172 |
| Position | Tail |
| Organism | Diaphorina citri (Asian citrus psyllid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.517 |
| Instability index | 65.73 |
| Isoelectric point | 7.79 |
| Molecular weight | 18869.34 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23117
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.84| 15| 15| 16| 30| 1
---------------------------------------------------------------------------
16- 30 (31.58/12.18) PSPLQGPPQLQGPQQ
32- 46 (32.26/12.56) PGQMPGPPQMQVQQE
---------------------------------------------------------------------------
|