<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23116
Description |
mediator of RNA polymerase II transcription subunit 16-like |
Sequence | MAIFFLNSKQIYKVARVRFIVREDADSVIVAANGETNSVIEVWELVENAYPVNSVFKKSVSLGVGPPAGDPGLKTITWRLQNSYAYEAKVLSVTTSKLCVSF |
Length | 102 |
Position | Tail |
Organism | Diaphorina citri (Asian citrus psyllid) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.191 |
Instability index | 18.30 |
Isoelectric point | 8.79 |
Molecular weight | 11243.83 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23116
No repeats found
No repeats found
|