<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23116
| Description |
mediator of RNA polymerase II transcription subunit 16-like |
| Sequence | MAIFFLNSKQIYKVARVRFIVREDADSVIVAANGETNSVIEVWELVENAYPVNSVFKKSVSLGVGPPAGDPGLKTITWRLQNSYAYEAKVLSVTTSKLCVSF |
| Length | 102 |
| Position | Tail |
| Organism | Diaphorina citri (Asian citrus psyllid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | 0.191 |
| Instability index | 18.30 |
| Isoelectric point | 8.79 |
| Molecular weight | 11243.83 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23116
No repeats found
No repeats found
|