<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23107
Description |
mediator of RNA polymerase II transcription subunit 9 |
Sequence | MDHQYSGGSWMMVPSQSSMAQDLRSLQPQYAQQQPQQQQQSHHHPSLASHFHLLHLVERLADAIESGTRNQHFDALVSELTAQFERCQQLLNSISDTMNTKGVVSKPIMIYLCHF |
Length | 115 |
Position | Middle |
Organism | Phoenix dactylifera (Date palm) |
Kingdom | Viridiplantae |
Lineage | |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.519 |
Instability index | 61.37 |
Isoelectric point | 6.27 |
Molecular weight | 13144.64 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23107
No repeats found
No repeats found
|