<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23099
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSVLNQYSYPTFCFHQKVYSLKPVKTSACLEVEHLFWYRHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLFFLELLQNANFRNAMAHPGSKELAHRQQYFFWKNYRNNRLKHILPRPIPEPAAPPAPAPVPAPLPAPSPAPVPSMTTAAAPALSPMQFVGAPGSALQKTDMRNAMGDRRKRKYNLCLSICIHIQHLIAQLYMNEGRLKGQMLFLGKGGQCWLLAGTNSVLVWYGRYAPVLIGTAHHGCNS |
| Length | 258 |
| Position | Middle |
| Organism | Phoenix dactylifera (Date palm) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.237 |
| Instability index | 53.79 |
| Isoelectric point | 9.59 |
| Molecular weight | 29635.22 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23099
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.89| 13| 18| 30| 47| 1
---------------------------------------------------------------------------
30- 42 (26.25/21.34) LEVEHLFWYRHYL
48- 60 (23.64/ 7.48) FEDEAFIGYLKYL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.53| 10| 88| 84| 93| 2
---------------------------------------------------------------------------
84- 93 (19.25/13.68) LQNANFRNAM
174- 183 (19.28/13.71) LQKTDMRNAM
---------------------------------------------------------------------------
|