<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23098
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSVLNQYSYPTFCFHQKVYSLKPVKTSACLEVEHLFWYRHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLFFLELLQNANFRNAMAHPGSKELAHRQQYFFWKNYRNNRLKHILPRPIPEPAAPPAPAPVPAPLPAPSPAPVPSMTTAAAPALSPMQFVGAPGSALQKTDMRNAMGDRRKRKYNLCLSICIHIQHLIAQLYMNEGRLKGQMLFLGKGGQCWLLADRVYAGQCSIIC |
Length | 244 |
Position | Middle |
Organism | Phoenix dactylifera (Date palm) |
Kingdom | Viridiplantae |
Lineage | |
Aromaticity | 0.14 |
Grand average of hydropathy | -0.239 |
Instability index | 56.19 |
Isoelectric point | 9.49 |
Molecular weight | 28189.66 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23098
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.89| 13| 18| 30| 47| 1
---------------------------------------------------------------------------
30- 42 (26.25/23.06) LEVEHLFWYRHYL
48- 60 (23.64/ 8.10) FEDEAFIGYLKYL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.53| 10| 88| 84| 93| 2
---------------------------------------------------------------------------
84- 93 (19.25/12.92) LQNANFRNAM
174- 183 (19.28/12.96) LQKTDMRNAM
---------------------------------------------------------------------------
|