<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23055

Description mediator of RNA polymerase II transcription subunit 15a
SequenceMKGPDNAVQNQAQGSEKESEALRVSVNSLEISASPLTENCNKLKEISHKSTLNFDEPSAEVKRILKVIAEISPEALSASVNEMREAVYLNDVMETSEFLDEPREMVQQQNQPDLIXQTGRKRSRSHSFNQFSDAEEPDYRKKKPRILENSSLLVELKEINHRLVDSVIVVGENVKAPGVAADDSEGLVIELLFNAVSFNMNIESHTFADKKSIIKPLRLFVPTNYPTSLPVIVDKELSEVSTECQKDLSTIAKSKLIHFLRCLDRTWSLEDIAXSWERCARETVLECAKTFGGETFSSIYGEWEKLSN
Length308
PositionTail
OrganismVigna radiata var. radiata (Mung bean) (Phaseolus aureus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
Aromaticity0.06
Grand average of hydropathy-0.445
Instability index39.89
Isoelectric point5.04
Molecular weight34448.50
Publications
PubMed=25384727

Function

Annotated function
GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23055
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     169.66|      64|     111|      42|     112|       1
---------------------------------------------------------------------------
   42-  100 (62.01/72.77)	......................................................KL........KEISHKstlnFDEPSAEVKRILK...VIAEISpEALsaSVNEMREAVYLNDVMETSEFLD
  101-  209 (78.46/62.90)	EPREMVQQQNQPdlixqtgrkrsrshsfnqfsdaeepdyrkkkprilenssllvEL........KEINHR....LVDSVIVVGENVKapgVAADDS.EGL..VIELLFNAVSFNMNIESHTFAD
  215-  253 (29.20/17.20)	KPLRLFVPTNYP............................................tslpvivdKELS........EVSTECQKDLS...TIAK..............................
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23055 with Med15 domain of Kingdom Viridiplantae

Unable to open file!