<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23052

Description mediator of RNA polymerase II transcription subunit 15a-like
SequenceMDNNNWRPNQSNEANMDTSDWRGGLQQESRQRIVNKIMDTLKRHLPVSGQEGLHELQKIAQRFEEKIFTAATSQSDYLRKISLKMLTMETKSQGSMANAPNQGGPSNKPPDPGLVIPPQVHNPGQQHSIPMPNQSQARQQLMQNNIASQSSGLTQTPIQNVGQNNPNMQNIPGQNSVGNTISQNSNMQNMFAGSQRQIQARQQVVPQQQQQSQNSQQFLYQQQIQHQLIRQKFHQQQQQQQNLLQPNQLQSSQQPVIQTSSVMQQAPMMQTSLPSIQHNQQSNNVQQSTQSVLQQHSQVIRQQQPQQTSIIHQQQTPMTQQSILPPQQQQQQQLMGAQGNASNMQHTQILGTQSNNVSDLQQPQQRLLAQQNNLSNLQQQQLINQQNNLSNMHQQLGNNVPGLQPQQVLGPQSGNSGMQTSQHSAHVLQQSQVQIQSQSQPNASNLLPSQVQQSQTQAPQHQLMPQIQSQPAQLQQQLGLQQQPNSLQRDMQQRLQASGPLLQQSTVLDQQKQLYQSQRPLPETSSTSLDSTAQTGQSSGGDWQEEVYQKVISYFLIIFQDSLPQQPKSEQLDKLKVYKMILERIITFLQVSKSNISPSFKEKLGSCEKQIINFINTNRPKNSSWQCHQKHLCSAVSDIGSVVSMNDRIAGSAPGNGSRAAVGEDLVAMTNCRLQARNFIAQDGANGTRRMKRYTYATPLNVVSSAGSMNDSVKQLTASEVSDLDSTATSRFKMPRVEILLFFVVMIYLMLKNMN
Length755
PositionTail
OrganismVigna radiata var. radiata (Mung bean) (Phaseolus aureus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
Aromaticity0.04
Grand average of hydropathy-0.841
Instability index70.47
Isoelectric point9.66
Molecular weight84688.72
Publications
PubMed=25384727

Function

Annotated function 
GO - Cellular Component
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23052
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     112.15|      26|      27|     188|     214|       1
---------------------------------------------------------------------------
  188-  214 (44.68/14.76)	QNMFAGSQRQIQArQQVVPQQ.QQQSQN
  216-  239 (32.82/ 6.32)	QQFLY..QQQIQ..HQLIRQKfHQQQQQ
  313-  334 (34.64/ 7.18)	QQQTPMTQQSILP.....PQQ.QQQQQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     392.44|      88|     113|     275|     386|       3
---------------------------------------------------------------------------
   94-  177 (101.28/20.05)	.GSMANAPNQ.............................GGPSNKPPDpglVIPPQVHNPGQ.QHSipMPNQSQarQQLM..Q...............nniaS....QSSGL..TQTPIQNVGQNNPNM..QNIP.GQNSV
  240-  310 (66.19/12.44)	.......................................................QQNLL.Q.PNQ..LQSSQQ..P......viqtssvmqqapmmqtslpSIQHNQQSNN..VQQSTQSVLQQHSQVIRQQQP.QQTSI
  335-  408 (122.09/26.09)	MGAQGNASNMQHTQ.......................ILGTQSNNVSD...LQQPQQRLLAQ.QNN..LSNLQQ..QQLINQQ................nnlSNMHQQLGNN..VP...............GLQP.QQ..V
  409-  525 (102.90/21.68)	LGPQSGNSGMQTSQhsahvlqqsqvqiqsqsqpnasnLLPSQVQQ.SQ...TQAPQHQLMPQiQSQ..PAQLQQ..QLGLQQQ.............pnslqrDMQQRLQASGplLQQST..VLDQQKQLYQSQRPlPETS.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     150.21|      45|      63|     604|     649|       4
---------------------------------------------------------------------------
  604-  649 (74.91/49.73)	LGSCEKQIINFINTNrPKNSSWQCHQKHLCSAVSDIGSVVSMNDRI
  669-  713 (75.30/45.43)	MTNCRLQARNFIAQD.GANGTRRMKRYTYATPLNVVSSAGSMNDSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.69|      15|      20|      56|      74|       5
---------------------------------------------------------------------------
   56-   74 (19.93/22.44)	LQKIAQrfeeKIFTAAT.SQ
   78-   93 (21.75/12.57)	LRKISL....KMLTMETkSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.06|      26|      28|     530|     556|       6
---------------------------------------------------------------------------
  526-  552 (39.32/27.54)	STSL....DSTAQTGQSSGGDwQEEVYQKVI
  553-  582 (39.74/21.75)	SYFLiifqDSLPQQPKSEQLD.KLKVYKMIL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23052 with Med15 domain of Kingdom Viridiplantae
Unable to open file!