<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23050

Description mediator of RNA polymerase II transcription subunit 15a-like
SequenceMDTSDWRGELQQKSRQRIVDKIMDTLKRHVSVSGPEELHELQQLAQRFEEKIFTAATSQSDYLRKLSSKLLIMENKSQGSMANAPNQDDVADGVEAW
Length97
PositionTail
OrganismVigna radiata var. radiata (Mung bean) (Phaseolus aureus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
Aromaticity0.05
Grand average of hydropathy-0.808
Instability index44.50
Isoelectric point5.32
Molecular weight11092.29
Publications
PubMed=25384727

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23050
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.42|      14|      28|       9|      23|       1
---------------------------------------------------------------------------
    9-   23 (20.47/19.05)	ELQQKSrQRIVDKIM
   40-   53 (24.95/17.38)	ELQQLA.QRFEEKIF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23050 with Med15 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




1) MDTSDWRGELQQKSRQRIVDKIMDTLKRHVSVSGPEELHELQQLAQRFEEKIFTAATSQSDYLRKLSSKLLIMENKSQGSMANAPNQDDVADGVEAW
1
97