<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23048
| Description |
uncharacterized protein LOC111241457 |
| Sequence | METNTKTLRWKLPEFRKGFMKQCLEGVLKQRYDEPLTSGLVRQLERYELKLNGTVHNEAEYCHWLSKIIKELFLQKPMNVVSKPCFSNSNVSGEVFPVQETGKSANMDWKEQVYQQIQKMNSAYFSKVYVSYLEMNRALQQLGYFPQVSNTNLVEKLIKRMKKTECVLALLKLKKCQITTDTKKILDEAENYGMTTKDVGDDYDIGMIKLVRIALQMNVRYYVMLACYGNETIFMHKPKGYIDSTKPNYICRLSKALYGLKQAPRAWFEKLRDSF |
| Length | 275 |
| Position | Tail |
| Organism | Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.468 |
| Instability index | 28.12 |
| Isoelectric point | 9.33 |
| Molecular weight | 32195.24 |
| Publications | PubMed=25384727
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23048
No repeats found
|