<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23046
| Description |
mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MEEQLGNGMMSRSKTTQELAMEGQQYLEETIEFAFQILSSMNDELCNPVLWSTSPSATSTSPNAPSATTDSASDNSNIHSDGATASAGAGGALEEARLRYKNAVAALRTILTAIPNSQKSKSFDTGSAASPADEAEIDKLEERASSLRKELANKNLLLKTLIDQLRDLISDISTWQSPLST |
| Length | 181 |
| Position | Head |
| Organism | Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.451 |
| Instability index | 56.50 |
| Isoelectric point | 4.56 |
| Molecular weight | 19387.22 |
| Publications | PubMed=25384727
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23046
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.98| 15| 45| 81| 95| 2
---------------------------------------------------------------------------
81- 95 (25.69/15.90) DGATASAGAGGA....LEE
124- 142 (20.29/11.09) DTGSAASPADEAeidkLEE
---------------------------------------------------------------------------
|