<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23034
| Description |
probable mediator of RNA polymerase II transcription subunit 26c isoform X1 |
| Sequence | MDLDDFRSILDTSGVDVWMFIDAAIAVASADCAAELKRRRDSIVESLYSATAAPPQCRNCGDGHRLRPNGHQVAKQNSPSPSPERQPQRRAAAAANSPVTPQSLENDDGGEELDPYGGLFDDEQKKILDIKEQLEEPDQSEDSLVELLQSLADMDITFQALKETDIGRHVNRLRKHPSNDVRRLVKLLVRKWKEIVDEWVKLNPQGGSNTLMADGDSPVQKTTQNGHHHQVEIPDFAYSPNPHNGSSGSDRNNSEAEHKPKVIPRSEPRPKPTPAPSVSTPASASQNRQRQSSFDAERLASARRRLQENYKEAENAKRQRTIQVMDINELPKSKPKNAFFGKNKGGGGSQGRHW |
| Length | 354 |
| Position | Unknown |
| Organism | Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.982 |
| Instability index | 62.59 |
| Isoelectric point | 6.57 |
| Molecular weight | 39367.14 |
| Publications | PubMed=25384727
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23034
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 161.96| 37| 37| 221| 257| 1
---------------------------------------------------------------------------
194- 219 (29.85/10.38) ............EIVDEWVKL..NPQGGSNTL.........MADGD.SPV
221- 257 (65.96/29.72) KTTQNGHHHQ.VEIPDFAYSP..NPHNGSSGS.........DRNNS.EAE
259- 297 (35.22/13.26) KP.......K.V.IPRSEPRP..KPTPAPSVStpasasqnrQRQSSfDAE
311- 344 (30.93/10.96) KEAENAKRQRtIQVMDINELPksKPKNAFFGK.........NK.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.97| 21| 44| 50| 70| 3
---------------------------------------------------------------------------
50- 70 (43.30/23.79) ATAAP..PQCRNCGD.GHRLRPNG
94- 117 (30.68/14.98) AANSPvtPQSLENDDgGEELDPYG
---------------------------------------------------------------------------
|