<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23033

Description mediator of RNA polymerase II transcription subunit 15a-like
SequenceMHTNRGWMNLSRINTEYERGVEEFIEFAQRNASTNGDDEVKFRCPCVNYLNGRKLNATDIREHLICDGFIRSYTTWIWHGELIDFPIVSPTENVYDSTMDMEDRSEEDNLEDMIRDVGVEAFAQAHVYETMSTDAETPLYASSTKFTRLSAVLKLMNLKATNGWTEKNGSALKVVWYLPLVARLKRLFANPKDTKNLRWHADERTTDGLLRHPTDSKQWKNVDQEFPXFGQECRNLRFGLATDXMNPFGNLSTNHSCWPVILIIYNLSPGLCMKRKYMMLSMLISGPKQLGNDINVYLRPLVEDFKLVWVDGVEIFDAFASETFMMYAMLFCTINDFPAYGNLSGYSPLQAKPSTQALGTQNFYIWKDVSQQCKPLQAKPSTQVLGAQNSHIWKDVSQQIKPQQAKIIPQSLETQNSCLWKDVSHQNKPCLKEQQLKIVEAEPSTQQLGPQNSSILNLVSQPNKPCLKEQQVEKQYSNSPQHVDQVSIMKGPDNAVQNQAQGSEKESEALRVSVNSLEISASPLTENCNKLKEISHKSTLNFDEPSAEVKRILKVIAEISPEALSASVNEMREAVYLNDVMETSEFLDEPREMVQQQNQPDLIXQTGRKRSRSHSFNQFSDAEEPDYRKKKPRILENSSLLVELKEINHRLVDSVIVVGENVKAPGVAADDSEGLVIELLFNAVSFNMNIESHTFADKKSIIKPLRLFVPTNYPTSLPVIVDKELSEVSTEXQKDLSTIAKSKLIHFLRCLDRTWSLEDIAXSWERCARETVLECAKTFGGETFSSIYGEWEKLSN
Length796
PositionTail
OrganismVigna radiata var. radiata (Mung bean) (Phaseolus aureus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
Aromaticity0.08
Grand average of hydropathy-0.479
Instability index43.44
Isoelectric point5.45
Molecular weight90002.97
Publications
PubMed=25384727

Function

Annotated function
GO - Cellular Component
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23033
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     185.11|      24|      24|     348|     371|       1
---------------------------------------------------------------------------
  348-  371 (51.36/32.48)	PLQAKPSTQALGTQNFYIWKDVSQ
  375-  398 (51.07/32.26)	PLQAKPSTQVLGAQNSHIWKDVSQ
  402-  425 (46.47/28.71)	PQQAKIIPQSLETQNSCLWKDVSH
  439-  461 (36.23/20.83)	.VEAEPSTQQLGPQNSSILNLVSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.92|      14|     108|     523|     537|       2
---------------------------------------------------------------------------
  523-  536 (24.64/13.70)	PLTENCNKLKEISH
  545-  558 (19.28/ 7.05)	PSAEVKRILKVIAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     139.47|      47|     108|     138|     199|       3
---------------------------------------------------------------------------
  138-  199 (62.28/84.51)	PLYASSTKFTRLSAVLKLMNLkaTNGWTEKN...............GSALKVvwYL.PLVarlkrlfanpKDTKnLRW
  247-  309 (77.19/55.21)	PFGNLSTNHSCWPVILIIYNL..SPGLCMKRkymmlsmlisgpkqlGNDINV..YLrPLV..........EDFK.LVW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.29|      11|      33|     427|     437|       4
---------------------------------------------------------------------------
  427-  437 (23.11/12.40)	NKPCLKEQQLK
  463-  473 (23.18/12.46)	NKPCLKEQQVE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23033 with Med15 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) EQQVEKQYSNSPQHVDQVSIMKGPDNAVQNQAQGSEKESEALRVSVNS
469
516

Molecular Recognition Features

MoRF SequenceStartStop
NANANA