<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23033

Description mediator of RNA polymerase II transcription subunit 15a-like
SequenceMHTNRGWMNLSRINTEYERGVEEFIEFAQRNASTNGDDEVKFRCPCVNYLNGRKLNATDIREHLICDGFIRSYTTWIWHGELIDFPIVSPTENVYDSTMDMEDRSEEDNLEDMIRDVGVEAFAQAHVYETMSTDAETPLYASSTKFTRLSAVLKLMNLKATNGWTEKNGSALKVVWYLPLVARLKRLFANPKDTKNLRWHADERTTDGLLRHPTDSKQWKNVDQEFPXFGQECRNLRFGLATDXMNPFGNLSTNHSCWPVILIIYNLSPGLCMKRKYMMLSMLISGPKQLGNDINVYLRPLVEDFKLVWVDGVEIFDAFASETFMMYAMLFCTINDFPAYGNLSGYSPLQAKPSTQALGTQNFYIWKDVSQQCKPLQAKPSTQVLGAQNSHIWKDVSQQIKPQQAKIIPQSLETQNSCLWKDVSHQNKPCLKEQQLKIVEAEPSTQQLGPQNSSILNLVSQPNKPCLKEQQVEKQYSNSPQHVDQVSIMKGPDNAVQNQAQGSEKESEALRVSVNSLEISASPLTENCNKLKEISHKSTLNFDEPSAEVKRILKVIAEISPEALSASVNEMREAVYLNDVMETSEFLDEPREMVQQQNQPDLIXQTGRKRSRSHSFNQFSDAEEPDYRKKKPRILENSSLLVELKEINHRLVDSVIVVGENVKAPGVAADDSEGLVIELLFNAVSFNMNIESHTFADKKSIIKPLRLFVPTNYPTSLPVIVDKELSEVSTEXQKDLSTIAKSKLIHFLRCLDRTWSLEDIAXSWERCARETVLECAKTFGGETFSSIYGEWEKLSN
Length796
PositionTail
OrganismVigna radiata var. radiata (Mung bean) (Phaseolus aureus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
Aromaticity0.08
Grand average of hydropathy-0.479
Instability index43.44
Isoelectric point5.45
Molecular weight90002.97
Publications
PubMed=25384727

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23033
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     185.11|      24|      24|     348|     371|       1
---------------------------------------------------------------------------
  348-  371 (51.36/32.48)	PLQAKPSTQALGTQNFYIWKDVSQ
  375-  398 (51.07/32.26)	PLQAKPSTQVLGAQNSHIWKDVSQ
  402-  425 (46.47/28.71)	PQQAKIIPQSLETQNSCLWKDVSH
  439-  461 (36.23/20.83)	.VEAEPSTQQLGPQNSSILNLVSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.92|      14|     108|     523|     537|       2
---------------------------------------------------------------------------
  523-  536 (24.64/13.70)	PLTENCNKLKEISH
  545-  558 (19.28/ 7.05)	PSAEVKRILKVIAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     139.47|      47|     108|     138|     199|       3
---------------------------------------------------------------------------
  138-  199 (62.28/84.51)	PLYASSTKFTRLSAVLKLMNLkaTNGWTEKN...............GSALKVvwYL.PLVarlkrlfanpKDTKnLRW
  247-  309 (77.19/55.21)	PFGNLSTNHSCWPVILIIYNL..SPGLCMKRkymmlsmlisgpkqlGNDINV..YLrPLV..........EDFK.LVW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.29|      11|      33|     427|     437|       4
---------------------------------------------------------------------------
  427-  437 (23.11/12.40)	NKPCLKEQQLK
  463-  473 (23.18/12.46)	NKPCLKEQQVE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23033 with Med15 domain of Kingdom Viridiplantae
Unable to open file!