<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23031
Description |
uncharacterized protein LOC111240861 isoform X1 |
Sequence | MPPSFGLGESVEKQSLEIWQLLLPIVYGFLEIVVLSQTYVRTLTGVALRVIRDPAPGGSDPVDNSRRAYTTSAVIEMLRFFVKNASRTKSSSRSMDQNICSSAIFESPGWWDVVSGLGKALQKKGHLVEIVLLKYDCMQYDHVCNLRAPLYWEIFVHKGLNSARICLHATTXSIRGLXXLXS |
Length | 182 |
Position | Kinase |
Organism | Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.082 |
Instability index | 55.78 |
Isoelectric point | 8.94 |
Molecular weight | 19874.84 |
Publications | PubMed=25384727
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23031
No repeats found
|