<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23023
Description |
Mediator of RNA polymerase II transcription subunit 16 |
Sequence | MADCCQPLGKVPDDARALEAPRGRSHAVPVVLTEAPAHTSSCLSVHELFLPKRTQFPLLPLTACLAGAIPRRVSWLCPVPPRSPCDRARRACCRGGTMDLAYVCEWEKWPKSTHCPSGPLACAWSCRNLIAFTTDLRSDDQDLTRMIHILDTEHPWDVHSIPSEHSEAITCVGSVVEGDPIVALSWLHNGVKLALHVEKSGVSSFGEKFSRVKFSPSLTLFGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALADIAFTGGGNIVVATADGSSASPVQFYKVCVGVVSEKCRVDTELLVLASAGHHGQASVGDKPPMILKWRILSATNDLDRVSAVALPKLPISLTNTDLKVASDTQFYPGLGLALAFHDGSVHVVHRLSLQTMAVFYSSAAPRPVDEPALKRPRTAGPAVHFKAMQLSWTSLALVGVDNYGKLSVLRVSPSMGHPLDVGLALRHLLFLLEYCMVTGYDWWDILLHVQPGMVQSLVEKLHEEYT |
Length | 506 |
Position | Tail |
Organism | Tarsius syrichta (Philippine tarsier) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Tarsiiformes> Tarsiidae>
Carlito.
|
Aromaticity | 0.07 |
Grand average of hydropathy | 0.119 |
Instability index | 40.49 |
Isoelectric point | 7.58 |
Molecular weight | 54801.86 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23023
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.92| 25| 81| 263| 292| 1
---------------------------------------------------------------------------
263- 287 (41.35/23.68) VALADIAFTGGGNIVVATADGSSAS
348- 366 (28.95/12.69) VALPKLP......ISLTNTDLKVAS
374- 388 (17.62/13.28) LGLA.LAFHDGSVHVV.........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.21| 13| 60| 51| 64| 3
---------------------------------------------------------------------------
51- 64 (22.95/15.91) PKRTQFPLLPLtAC
110- 122 (29.26/16.08) PKSTHCPSGPL.AC
---------------------------------------------------------------------------
|