<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22996
Description |
Uncharacterized protein |
Sequence | MSSSMGSGMFPGQQPPGSHPVGGPGGPGQSGLLSGAPGNRSQGANTLVDDLEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKELLVQKHLSKLHHWQQVLEDVSIQHRKPSDLPPPGPLAFLEQASASLPPAPLKQT |
Length | 183 |
Position | Head |
Organism | Esox lucius (Northern pike) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Esociformes>
Esocidae> Esox.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.509 |
Instability index | 57.22 |
Isoelectric point | 5.51 |
Molecular weight | 19906.19 |
Publications | PubMed=25069045
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22996
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.34| 26| 30| 92| 119| 1
---------------------------------------------------------------------------
92- 119 (37.22/30.89) R...QTECFFLQKRLQlSVQKPEQVIkEDVS
122- 150 (41.12/24.87) RnelQRKELLVQKHLS.KLHHWQQVL.EDVS
---------------------------------------------------------------------------
|