<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22994
| Description |
Uncharacterized protein |
| Sequence | TSCTVSQIQPTQTLAGGSMSQPGLLQPSSIQQAQTQQQQLSQQQDFDPVHRFKMLIPQLKESVQNVMKIASLNLAHNTTIDNGTKSSDSSVQRFDKSLEEFYALCDQLELCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESMSYAQYLCMIKSQISCAKDIHNALLECSKKIAGKGQPPGMM |
| Length | 187 |
| Position | Tail |
| Organism | Cynoglossus semilaevis (Tongue sole) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Pleuronectiformes> Pleuronectoidei> Cynoglossidae>
Cynoglossinae> Cynoglossus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.399 |
| Instability index | 69.60 |
| Isoelectric point | 6.37 |
| Molecular weight | 20569.22 |
| Publications | PubMed=24487278
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22994
No repeats found
No repeats found
|