<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22993
Description |
Uncharacterized protein |
Sequence | MMASQQQQAGGSMSQPGLLQPSSIQQAQTQQQQLSQQQDFDPVHRFKMLIPQLKESVQNVMKIASLNLAHNTTIDNGTKSSDSSVQRFDKSLEEFYALCDQLELCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESMSYAQYLCMIKSQISCAKDIHNALLECSKKIAGKGQPPGMM |
Length | 181 |
Position | Tail |
Organism | Cynoglossus semilaevis (Tongue sole) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Pleuronectiformes> Pleuronectoidei> Cynoglossidae>
Cynoglossinae> Cynoglossus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.455 |
Instability index | 71.04 |
Isoelectric point | 6.40 |
Molecular weight | 20013.62 |
Publications | PubMed=24487278
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22993
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.42| 14| 33| 4| 26| 1
---------------------------------------------------------------------------
4- 21 (21.52/23.12) SQQQQaggsMSQPGLLQP
29- 42 (26.90/ 7.90) TQQQQ....LSQQQDFDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.18| 16| 34| 110| 125| 2
---------------------------------------------------------------------------
110- 125 (30.36/24.24) YECLSQS.IDSAKHSPN
146- 162 (26.82/20.58) YLCMIKSqISCAKDIHN
---------------------------------------------------------------------------
|