<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22991
| Description |
Uncharacterized protein |
| Sequence | MGASAKRRPKVQPSTLVLPPQYVDDVISRIGRMFPDMTIELFRPNGTSAVLLVTLGKVFKALLVMRSLFIDRTLVRGYNENNYNEDGKVRVYTHKPCVTDHASTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQSPCQRCGRFLQDGLPPTWRDFRTLEAFHDTCRM |
| Length | 167 |
| Position | Tail |
| Organism | Cynoglossus semilaevis (Tongue sole) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Carangaria> Pleuronectiformes> Pleuronectoidei> Cynoglossidae>
Cynoglossinae> Cynoglossus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.214 |
| Instability index | 40.65 |
| Isoelectric point | 9.73 |
| Molecular weight | 19310.33 |
| Publications | PubMed=24487278
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22991
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.14| 14| 25| 124| 138| 1
---------------------------------------------------------------------------
124- 138 (24.98/21.40) TWlRSYIKL..FQSPCQ
151- 166 (23.16/14.37) TW.RDFRTLeaFHDTCR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.56| 13| 24| 30| 42| 2
---------------------------------------------------------------------------
30- 42 (24.56/19.34) IGRMFPDMTI..ELF
55- 69 (16.00/10.21) LGKVFKALLVmrSLF
---------------------------------------------------------------------------
|