<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22981
| Description |
Mediator complex subunit 28 |
| Sequence | MASSMGGMFPGQQPPGAHPVGGPGGPGQPGFPGSASRVPGNNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVVKEDVSELRNELQRKELLVQKHLTKLHHWQQVLEDVSLQHRKPSDLPPPGPLAFLEQASASLPPAPLKPN |
| Length | 180 |
| Position | Head |
| Organism | Amphiprion percula (Orange clownfish) (Lutjanus percula) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Pomacentridae> Amphiprion.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.499 |
| Instability index | 53.51 |
| Isoelectric point | 5.51 |
| Molecular weight | 19654.01 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22981
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.43| 23| 30| 90| 113| 2
---------------------------------------------------------------------------
90- 113 (34.11/23.38) QTECFFLQKRLQlSVQKPEQVVKE
123- 145 (39.32/22.86) QRKELLVQKHLT.KLHHWQQVLED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.80| 15| 22| 41| 55| 4
---------------------------------------------------------------------------
41- 55 (25.01/19.88) NNTLVDELEASFEAC
66- 80 (26.79/21.75) NGTDQEEIRTGVDQC
---------------------------------------------------------------------------
|