<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22972
Description |
Uncharacterized protein |
Sequence | MLQMLFADFLRTFIGNRRRSIMTDKPISFSNYSPTSSPQFIFEQTLAAVLKDPSTKKIGLIGRYLEKTALSSIIELRFGHYVEKQYVCLLKMLIVVNNGVFEFVQIIAPHEDWSYMDASHRQIDILRESRYIVYRKMSVQANIHLMQTIMPCMDFRNAHTLSYIFTLFAKFSSVFDVKCRFCKKIMKDFLPPLIFDMRYPKNALHESCR |
Length | 209 |
Position | Tail |
Organism | Dracunculus medinensis (Guinea worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Dracunculoidea> Dracunculidae> Dracunculus.
|
Aromaticity | 0.13 |
Grand average of hydropathy | 0.008 |
Instability index | 53.42 |
Isoelectric point | 9.47 |
Molecular weight | 24595.75 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22972
No repeats found
No repeats found
|