<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22967
| Description |
Uncharacterized protein |
| Sequence | MDKMTMKLRKLLENRSLASLNLAPSLDQLDVQLDNSDSLRRVDWLVGRNEAYRWLRRANYRTEAIQLSLASCGRFLRFTIPVSIVFRNTILVPLSSASDLKNLAAPQMSFALLDSNTRNPILYVKVGEVMHCLITFGNLFMENIIVRGLDESHCVPEYTARSRTTAAVSQGFSQAMSDLLCSAAVNEFATFLLPNFDNVRSHLNSKSTIDYSFGFQNRHLPPSDHRLPTVSQLDLTTPSRHVTFVRVTEAARIALVHFSTTTEPPTQVSALHQFCDWLQTYVRLFTEPCMNCGQLLGQDSALPVLRTFHTNPANARAQHEHCRVIASTV |
| Length | 329 |
| Position | Tail |
| Organism | Mesocestoides corti |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Mesocestoididae> Mesocestoides.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.094 |
| Instability index | 50.71 |
| Isoelectric point | 8.66 |
| Molecular weight | 37055.01 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22967
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.98| 28| 197| 12| 44| 1
---------------------------------------------------------------------------
12- 44 (43.46/35.83) LENRslaslNLAPSLDQLDV..QLDNSDSLRRVDW
215- 244 (48.53/29.32) FQNR.....HLPPSDHRLPTvsQLDLTTPSRHVTF
---------------------------------------------------------------------------
|