<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22958
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MATPPVLPQLPTNFEANPPPMGPTPPQQPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDWTCNNEQLRSQSIHPLDLSHLLKMTGTEYMLSEVMEPHLFVFRKQKRDSAEKVTPMLTYYVLDGSIYQAPQLCSVFAARVGRALYYISKAFGTAASKLEKIGYGIALLLTFSLLSRSDQISFVIEGYISCFQFE |
| Length | 200 |
| Position | Head |
| Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.073 |
| Instability index | 49.35 |
| Isoelectric point | 5.61 |
| Molecular weight | 22697.91 |
| Publications | PubMed=16973872
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22958
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.15| 14| 30| 38| 51| 1
---------------------------------------------------------------------------
38- 51 (29.25/17.25) CFRDQLW.LNTYPLD
69- 83 (22.90/12.34) CNNEQLRsQSIHPLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.33| 16| 31| 93| 108| 3
---------------------------------------------------------------------------
93- 108 (30.28/20.32) TEYMLSEVM..EPHL.FVF
124- 142 (19.05/10.48) TYYVLDGSIyqAPQLcSVF
---------------------------------------------------------------------------
|