<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22916
| Description |
Uncharacterized protein |
| Sequence | MLSMEIRSQNAMPAAPMDPEASHSMPPQVQNQGLFLPLLSSTDQSQARQQLVSQNMQSIPGVSQNSVGNSMGQGIPSTMFANSQRQMPASLDSTAQTGHANGADWQEQIYQKHDSHPQQPKSEQLEKLEVFKAMLERLITFLQVSKNNITPSFKEKLGSNEKHIVSFLNPSRFRKPIPNLQLGQLPQPHVQPMQQSQSPVPQLQSHENQLNTQLPSMNVQGSIPTMQQNNMSSLQHGSLSSLSGVSMSQPIMMMWDERF |
| Length | 259 |
| Position | Tail |
| Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.650 |
| Instability index | 63.85 |
| Isoelectric point | 6.71 |
| Molecular weight | 28824.30 |
| Publications | PubMed=16973872
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22916
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.66| 19| 20| 197| 216| 2
---------------------------------------------------------------------------
197- 216 (29.95/16.66) QSPVPQLQsHENQLNTQLPS
220- 238 (34.71/15.83) QGSIPTMQ.QNNMSSLQHGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.86| 16| 20| 81| 96| 3
---------------------------------------------------------------------------
81- 96 (27.71/13.47) ANSQRQMPASLDSTAQ
103- 118 (32.15/16.56) ADWQEQIYQKHDSHPQ
---------------------------------------------------------------------------
|